Print Mode Video Only Audio Only Remove Channel Filter Channel A

News chronological

2 items before 1159353 (Channel B) (Keyword: "availability" (~3 currently found))

NPR (Will Stone) - What's behind the push to make peptide therapies more readily available

Marketed for longevity and wellness benefits, the unproven therapies are sold through a grey market online. Compounding pharmacies say they should be able to make them legally to meet demand.

Marketed for longevity and wellness benefits, the unproven therapies are sold through a grey market online. Compounding pharmacies say they should be able to make them legally to meet demand.Open

Channelt.me/News_Wire2
Sourcehttps://www.npr.org/2026/07/08/nx-s1-5885073/fda-peptides-compounding-pharmacies
Keywordsfdarfk-jrrobert-f-kennedy-jrpeptidescompounding-pharmacyhealthcarehealthlongevitywellnessmedicinepharmaceuticalstelehealthregulationpolicyfederal-governmentgrey-marketmedical-researchnprdrug-regulationavailability

ABCNEWS - Still thinking about World Cup tickets? Here's where prices, availability stand

The World Cup starts Thursday, and FIFA is charging record prices at the 11 stadiums in the United States, three in Mexico and two in Canada

Channelt.me/News_Wire2
Sourcehttps://abcnews.com/Business/wireStory/thinking-world-cup-tickets-prices-availability-stand-133767236
Keywordsfifaworld-cupsoccersportsusamexicocanadaabc-newsticketspricesavailabilityeconomicsfinancesports-businessworld-cup-2026stadiumsinternational-soccersalesresale-market