The director narrates a scene from his movie that is a continuation, of sorts, of a sequence he filmed for his feature-length debut, “Duel,” in 1971.
| Keywords | steven-spielbergdisclosure-dayduelmoviescinemahollywoodentertainmentsuspensefilm-makingdirectingnytimespop-culturestorytellingclassic-cinemafeature-film |
Decades of bottled-up hopes and frustrations have created a frenzy around the New York Knicks that has brought out the worst in some fans.
| Keywords | knicksnbabasketballnew-york-citynycmadison-square-gardensportsnba-finalsbrawlscivil-disorderpublic-safetypolicearrestsmanhattancelebrationsfrenzynew-york-knicks |
Some Knicks fans have predicted series sweeps. Others, conditioned by decades of failure, pay more heed to jinxes and superstitious rituals.
| Keywords | knicksnbabasketballnew-york-knickssportsmadison-square-gardennycnew-york-citysuperstitionjinxplayoffsmanhattannba-finalssports-culturenytimeslebron-jamescelebrity-politicspop-culture |
Competitions that give soldiers a brief break from the front have a festival-like atmosphere, a mix of potentially deadly weapons and frolicking children.
| Keywords | ukrainedrone-raceswarmilitary-technologydronesconflictdefense-techworld-newsmilitarygeopoliticswarfareair-strikenational-securityforeign-policyfestivalssoldiersfrontlinenytimes |
A lawsuit by a group of 17 county law enforcement officers is another front in the Trump-era fight over local police’s role in immigration enforcement.
| Keywords | marylandiceimmigrationlawsuitsherifftrumplaw-enforcementborder-securitydeportationmass-deportationtom-homanlegalpoliticsstate-vs-federalpublic-safetyusgovernmentpolicingimmigration-policy |
Our critic Jason Farago on how the artist conceived a new way forward for landscape painting.
| Keywords | gerhard-richterjason-faragonytimesartpaintinglandscapecontemporary-artcultureveneziaitalyzwirnerdesignexhibitioncriticismvisual-arts |
Once the guardian of the bipartisan pro-Israel consensus, it is now a polarizing force in the party.
Astronomical ticket prices, soaring security costs and concern over traffic and transit snarls is mixed with pride in host cities and excitement over the U.S. team.
| Keywords | world-cupfifasoccerusasportseconomicspricesticketsworld-cup-2026businessfinancetraveltrafficsecurityus-newshost-citiesinternational-soccersports-businessresale-market |
Several closely watched races are taking place in New York City and beyond. Nine days of early voting will precede Primary Day on June 23.
| Keywords | new-yorknyelectionvotingprimary-electionearly-votingpoliticsus-politicsdemocracyelectoral-processnycdemocratrepublican-partysenate-racecongresspolitical-campaignselection-cycle |
Groups tied to OpenAI, Anthropic and other industry players have spent $16 million trying to pick the next member of Congress from Manhattan.