News chronological

Showing 10 items before 1163567

AMERICANALMANAC (Alex Tanzer) - Royal household staff receive alcohol training on grey-area drinking

Buckingham Palace staff sat through alcohol awareness training on grey-area drinking and intoxicated colleagues, years before a Christmas party still ended with smashed glasses and an arrest. Consultants from Alcohol Change UK were brought in to speak to the royal household about workplace drinking risks, the Daily Mail reported. Palace human resources organized the sessions […] The post Royal household staff receive alcohol training on grey-area drinking appeared first on American Almanac .

Buckingham Palace staff sat through alcohol awareness training on grey-area drinking and intoxicated colleagues, years before a Christmas party still ended with smashed glasses and an arrest. Consultants from Alcohol Change UK were brought in to speak to the royal household about workplace drinking risks, the Daily Mail reported . Palace human resources organized the sessions as part of a wider run of staff wellbeing initiatives several years ago. The material covered how to handle intoxicated coworkers and what the charity labels “grey area drinking.” Richard Piper, chief executive of Alcohol Change UK, told The Times: "We've worked with the royal household, with all workplaces where there may be the ability to implement better…Open

How does Alcohol Change UK describe its approach to alcohol education in the workplace?
Alcohol Change UK focuses on "inclusion" and avoiding "sober shaming" or the stigma associated with whether drinking is good or bad. Richard Piper, the charity's chief executive, noted that the goal is to focus on health and individuals to make everyone feel included, pointing out that over 20 per cent of the population does not drink alcohol.
Q&A ID 0d9bc0ce-6fea-4ae9-951a-a92031fd023a
What incident occurred during the royal staff Christmas drinks in December 2024?
In December 2024, after holding Christmas drinks at the palace, approximately 50 staff members went to All Bar One on Victoria Street. The night ended in disorder when a then-24-year-old palace maid was arrested for allegedly punching the bar manager and hurling glasses around the room while others attempted to calm her down.
Q&A ID 8001210c-15c8-4d4f-b39b-ef6b3f958f9c
Who provided the alcohol awareness training to the royal household staff?
Consultants from Alcohol Change UK provided the training. Richard Piper, the chief executive of Alcohol Change UK, stated that the organization works with various workplaces to implement better policies regarding drinking risks, focusing on health, safeguarding, and inclusion rather than simple rules about staying sober.
Q&A ID 2f9a9a6a-3fbd-426b-95e7-3f21733c5e06
What specific type of training did Buckingham Palace staff receive regarding alcohol consumption?
Staff underwent alcohol awareness training focused on "grey-area drinking" and how to handle intoxicated colleagues. The sessions were organized by Palace human resources as part of wider staff wellbeing initiatives several years ago, and consultants from the charity Alcohol Change UK were brought in to lead them.
Q&A ID e018f695-fb47-43b0-953a-66ea7cb0927c
Keywordsmonarchyroyal-familybuckingham-palaceukbritainking-charlesprince-harrymeghan-markleentertainmentscandallegaluk-newslondonalcohol-awarenessworkplace-cultureinclusionidentity-politicssocial-issuesbritish-monarchyking-charles-iii

AMERICANALMANAC (Jack Newsome) - British tourist treated after pufferfish bite off Greek island

A British tourist was rushed for treatment after a bite while swimming off Zante, as an invasive pufferfish species spreads through Mediterranean waters and raises fresh safety alarms. The woman was in the water at Kalamaki on the Greek island of Zante when she was bitten and sought urgent care at a private clinic, The […] The post British tourist treated after pufferfish bite off Greek island appeared first on American Almanac .

A British tourist was rushed for treatment after a bite while swimming off Zante, as an invasive pufferfish species spreads through Mediterranean waters and raises fresh safety alarms. The woman was in the water at Kalamaki on the Greek island of Zante when she was bitten and sought urgent care at a private clinic, The Sun reported . She told medics she believed a monkfish had bitten her. Staff gave her first aid for the wound. Port authority sources said the incident will be investigated. No name, age, or exact date for the bite was released. The severity beyond first aid and urgent treatment was not detailed. Invasive fish moves far beyond tropical waters The silver-cheeked pufferfish, Lagocephalus sceleratus, is native to tropical…Open

What specific sightings of the silver-cheeked pufferfish have been documented in the Adriatic?
The first Adriatic sighting occurred in October 2012 on the northern side of Croatia’s Jakljan Island. In May of last year, scientists caught a 52-centimeter male weighing just over a kilo at a depth of 65 feet in Medulin Bay off Croatia, which was only the fourth recorded catch in the Adriatic and the farthest north recorded at that time.
Q&A ID d056ec11-4418-40f9-9781-199f452d9adb
How has the spread of the silver-cheeked pufferfish impacted the fishing industry and tourism in the Mediterranean?
The species has caused damage by tearing into nets, with estimated losses of approximately £8,000 a year per fishing boat. Additionally, Dr. Neven Iveša warned that bites from these fish threaten the image and appeal of tourist destinations, potentially leading to economic losses in local tourism and related industries.
Q&A ID ea313c02-d5fd-49e1-8a91-3434345010e5
What are the characteristics and risks associated with the invasive silver-cheeked pufferfish (Lagocephalus sceleratus)?
Native to the tropical waters of the Indian and Pacific oceans, the silver-cheeked pufferfish has moved through the Suez Canal into the Mediterranean. It is known for aggressive behavior that can cause significant injuries, such as partial amputation of fingers, and its flesh and organs contain tetrodotoxin, a poison that can cause heart and lung failure if ingested.
Q&A ID aa079278-3b94-4a03-bfa9-ee8285337c1d
What happened to a British tourist while swimming at Kalamaki on the Greek island of Zante?
A British tourist was bitten while swimming in the water at Kalamaki on the island of Zante and had to seek urgent care at a private clinic; although she initially believed a monkfish had bitten her, the incident occurred amid alarms regarding an invasive pufferfish species spreading through Mediterranean waters.
Q&A ID e99165ee-71ec-4a58-9be2-ea402dda61a7
Keywordspufferfishshark-attackanimal-attackmarine-lifeoceangreecezanteinvasive-speciessilver-cheeked-pufferfishmediterranean-seatravel-safetyswimmingcaught-on-camerabreaking-newsnaturewildlifesafetyinjurymedical-emergencytourismfishingtetrodotoxinbiologysea-lifemediterraneancroatiaadriatic-seatravel-newspublic-safetyocean-safety

AMERICANALMANAC (Alex Tanzer) - Rob Lowe picks Nastassja Kinski as his top on-screen kiss

Rob Lowe crowned Nastassja Kinski his best on-screen kiss on live TV, calling her the most beautiful woman he had ever seen and admitting the scene left him terrified. The 62-year-old actor answered the question during a game of “Plead the Fifth” on Watch What Happens Live with host Andy Cohen, and he did not […] The post Rob Lowe picks Nastassja Kinski as his top on-screen kiss appeared first on American Almanac .

Rob Lowe crowned Nastassja Kinski his best on-screen kiss on live TV, calling her the most beautiful woman he had ever seen and admitting the scene left him terrified. The 62-year-old actor answered the question during a game of “Plead the Fifth” on Watch What Happens Live with host Andy Cohen, and he did not hedge. Cohen ran through a long list of Lowe’s on-camera partners, including Demi Moore, Rashida Jones, Kim Cattrall, Calista Flockhart, and Meg Tilly. Lowe still went straight to Kinski. His reason was blunt. “Have a look at her.” Lowe did not stop there. “At that moment in time, she was probably the most beautiful woman I’d certainly ever seen.” He also said the moment shook him. “I was, like, very, very scared.”…Open

During which television segment did Rob Lowe name Nastassja Kinski as his top on-screen kiss?
Rob Lowe answered the question during a game of “Plead the Fifth” on the show "Watch What Happens Live" hosted by Andy Cohen.
Q&A ID 51b7b418-d472-4a46-ba0f-5056561cef4d
What specific moment from the 61st Academy Awards does Rob Lowe refer to as "the worst opening ever"?
Rob Lowe refers to his 1989 opening musical number at the 61st Academy Awards as "the worst opening ever," noting that he is "dragged, dragged every year" because the internet seems to prefer that clip over other major Oscar moments, such as the Will Smith and Chris Rock incident.
Q&A ID 8c24bf25-dcd6-485b-b115-392ae19c0137
Who is Rob Lowe's wife and when were they married?
Rob Lowe is married to Sheryl Berkoff, a makeup artist and jewelry designer whom he met on the set of the 1990 film "Bad Influence." They were married in July 1991.
Q&A ID 26945b94-d115-47e1-af1c-0754d1949ece
In which film did Rob Lowe and Nastassja Kinski appear together?
Rob Lowe and Nastassja Kinski shared the screen in the 1984 film "The Hotel New Hampshire," which was directed by Tony Richardson and adapted from the 1981 novel by John Irving.
Q&A ID 8ff3cdf7-6b07-4289-a507-91cc71954895
Keywordsentertainmenthollywoodcelebrityrob-lowenastassja-kinskicelebrity-newsmoviescinemawatch-what-happens-liveandy-cohenoscaracademy-awardswill-smithchris-rockcalifornialifestylepop-cultureactoractressfilm-industrycelebrity-interviewred-carpetentertainment-industry

AMERICANALMANAC (Sadie Smith) - Suns forward Dillon Brooks faces misdemeanor DUI charge months after Scottsdale stop

Phoenix Suns forward Dillon Brooks has been charged with a misdemeanor DUI in Scottsdale months after police pulled him over for alleged speeding early one March morning. Scottsdale prosecutors have now filed a criminal complaint against the 30-year-old Phoenix Suns forward for a misdemeanor driving-under-the-influence charge tied to that March arrest, Daily Mail reported. The […] The post Suns forward Dillon Brooks faces misdemeanor DUI charge months after Scottsdale stop appeared first on American Almanac .

Phoenix Suns forward Dillon Brooks has been charged with a misdemeanor DUI in Scottsdale months after police pulled him over for alleged speeding early one March morning. Scottsdale prosecutors have now filed a criminal complaint against the 30-year-old Phoenix Suns forward for a misdemeanor driving-under-the-influence charge tied to that March arrest, Daily Mail reported . The filing lands just as the Suns finished media day and turned toward the 2026-27 NBA season, a reminder that a high-profile athlete still answers to the same traffic laws as everyone else on an Arizona road. Police stop came after a claimed 85-in-a-45 run On March 6, around 1 a.m., officers pulled Brooks over in Scottsdale for traffic violations. Police claimed he was…Open

Does Dillon Brooks have any other recent legal matters mentioned in the reports?
Eight months prior to his March arrest, Brooks had filed for a new restraining order against the mother of his two children. This family-court matter is noted as being separate from the current DUI complaint.
Q&A ID f22291d0-d276-41a5-ba5a-1e273366c40d
When are the Phoenix Suns scheduled to begin their upcoming NBA season?
The Suns are scheduled to open their regular season on October 21 against the Portland Trail Blazers, followed by a home game against Golden State on October 24.
Q&A ID 6631f114-ee13-4160-8fb1-fc26a21e0461
What is Dillon Brooks' professional background and recent performance with the Phoenix Suns?
Dillon Brooks is a 30-year-old forward for the Phoenix Suns and a Canadian native. In the prior season, he averaged a career-high 20.2 points per game and shot 84.2 percent from the free-throw line.
Q&A ID 4fb86a39-292d-48ef-8be6-de8dfa26b3cd
What were the specific circumstances of Dillon Brooks' arrest in Scottsdale on March 6?
Around 1 a.m. on March 6, officers pulled Brooks over for traffic violations after he was allegedly traveling 85 mph in a 45 mph zone. He was booked at the Scottsdale City jail on suspicion of DUI and released approximately two hours later, around 3:30 a.m.
Q&A ID 4c12e0e1-dc77-4326-bd47-a03885f04127
Keywordsdillon-brooksphoenix-sunsnbasportsscottsdalearizonaduiarrestcrimelaw-enforcementpolicelegalcourtmisdemeanordriving-under-the-influencecelebritybreaking-newsbasketballcriminal-justicelawyerattorneyspeedingcriminal-chargesentertainmentathlete

AMERICANALMANAC (Alan Benson) - Hallmark axes Finding Mr. Christmas after two seasons amid fan outrage

Hallmark Channel has dropped its holiday reality series Finding Mr. Christmas after just two seasons, a move fans are slamming as a horrible decision that ends a show still building steam. The Sun reported that the network will not bring the series back for a third season, cutting short a format that mixed lighthearted competition […] The post Hallmark axes Finding Mr. Christmas after two seasons amid fan outrage appeared first on American Almanac .

Hallmark Channel has dropped its holiday reality series Finding Mr. Christmas after just two seasons, a move fans are slamming as a horrible decision that ends a show still building steam. The Sun reported that the network will not bring the series back for a third season, cutting short a format that mixed lighthearted competition with the channel’s signature Christmas charm. Host Jonathan Bennett, the Mean Girls alum who fronted the show, addressed the end of the run earlier this month and made clear the decision left him wanting more. Lead judge Melissa Peterman rounded out the core on-air team as ten aspiring male actors competed each season for a shot at Hallmark stardom. Bennett says the show built real traction Bennett told…Open

What has been the reaction from fans regarding the cancellation of Finding Mr. Christmas?
Fans on the HallmarkMovies subreddit expressed frustration and sadness, with some calling the cancellation a "horrible decision" and others noting the show had "so much potential" and was "campy, lighthearted fun."
Q&A ID e639e867-b89e-4b78-8f8f-d212bee1a0e2
What was the format of the Finding Mr. Christmas competition?
The series featured ten aspiring male actors competing each season in a format that mixed lighthearted competition with Hallmark's signature Christmas charm.
Q&A ID f0014d1e-5fa8-489f-8e5b-01fd452591fa
How did host Jonathan Bennett describe the cancellation of the show?
Jonathan Bennett stated that the cancellation fits a "familiar industry pattern" where shows are sometimes "randomly for no reason" canceled. He noted that the show had significant traction and growing audience energy, with people holding watch parties across the country.
Q&A ID 03f2b42f-ba65-44b5-896e-7eee04caf955
What was the prize for the winners of Finding Mr. Christmas?
Winners received the opportunity to star in a Hallmark movie. For example, Season 1 winner Ezra Moreland starred in Happy Howlidays alongside Jessica Lowndes, and Season 2 winner Craig Geoghan appeared in A Make or Break Holiday with Hunter King and Evan Roderick.
Q&A ID 9cecd6f4-4978-464d-8471-8fd05ceac179
Keywordsentertainmenthollywoodmediatelevisionhallmarkfinding-mr-christmasjonathan-bennettreality-tvchristmasholidaytv-showcancellationfan-outragebroadcastingstreamingpop-culturecelebrity-newsmedia-industrybusiness-newstv-ratings

AMERICANALMANAC (Alan Benson) - Andrew Garfield was terrified of Robert Redford — who walked onto set four hours late

Andrew Garfield says he was terrified sharing the screen with Robert Redford on “Lions for Lambs”, and the Hollywood legend showed up four hours late. The two-time Oscar nominee, 43, opened up about the 2007 war drama during an appearance on Amy Poehler’s “Good Hang” podcast this week, recalling nerves, a long wait, and a […] The post Andrew Garfield was terrified of Robert Redford — who walked onto set four hours late appeared first on American Almanac .

Andrew Garfield says he was terrified sharing the screen with Robert Redford on “Lions for Lambs”, and the Hollywood legend showed up four hours late. The two-time Oscar nominee, 43, opened up about the 2007 war drama during an appearance on Amy Poehler’s “Good Hang” podcast this week, recalling nerves, a long wait, and a director-star who ran on his own clock. Page Six reported Garfield’s account of working opposite Redford, the Oscar-winning star of “Butch Cassidy and the Sundance Kid” and “Indecent Proposal,” who also directed the film. Garfield did not dress it up as a polished Hollywood memory. He said he was pinching himself, and then stuck waiting. Garfield waited hours, then the nerves burned off On the podcast,…Open

What is the premise of the 2007 film "Lions for Lambs"?
"Lions for Lambs" is an American war drama that connects the stories of a U.S. platoon in Afghanistan, a senator, a reporter, and a California college professor.
Q&A ID ea5436d3-390e-4987-8efd-775ef7f06b79
When and where did Robert Redford pass away?
Robert Redford passed away on September 16, 2025, at his home in Sundance, located in the mountains of Utah, where he died in his sleep at the age of 89.
Q&A ID be9840da-00c1-4b3d-86c1-f7bb5d900a3c
How did Robert Redford manage his dual roles as actor and director during the filming of "Lions for Lambs"?
Because Redford was acting and directing simultaneously, he would shoot his own coverage first and then immediately ask his co-star, Andrew Garfield, for his opinion by asking, "What do you think?"
Q&A ID c10058bd-564f-43a9-85bf-10cb9e9196dd
What did Andrew Garfield reveal about Robert Redford's behavior on the set of the 2007 war drama "Lions for Lambs"?
Andrew Garfield stated during an appearance on Amy Poehler’s “Good Hang” podcast that he was terrified of sharing the screen with Robert Redford and that Redford arrived on set four hours late. Garfield noted that Redford was famously late and appeared unbothered, dressed in double denim, and seemed unaware of the delay.
Q&A ID bf57d78d-2b9b-4e1a-937e-b8dba39f0d23
Keywordshollywoodentertainmentmoviespop-culturefilm-industrycelebrityoscarandrew-garfieldrobert-redfordlions-for-lambsamy-poehlergood-hangcelebrity-newsusaamericaculture-waractingcinemabox-officesundanceutahbiopicwar-dramaentertainment-news

AMERICANALMANAC (Sadie Smith) - Venezuelan illegal immigrant faces federal assault charge after ICE shooting in Austin

A Venezuelan illegal immigrant with a deportation order faces assault charges after ICE shot him in Austin, and local leaders blasted federal officers. Wilber Rafael Garces-Perez, 28, went before a U.S. magistrate judge in Austin and was formally notified he faces one federal count of assaulting a federal officer after an Immigration and Customs Enforcement […] The post Venezuelan illegal immigrant faces federal assault charge after ICE shooting in Austin appeared first on American Almanac .

A Venezuelan illegal immigrant with a deportation order faces assault charges after ICE shot him in Austin, and local leaders blasted federal officers. Wilber Rafael Garces-Perez, 28, went before a U.S. magistrate judge in Austin and was formally notified he faces one federal count of assaulting a federal officer after an Immigration and Customs Enforcement stop on Sept. 20 ended in a pursuit and gunfire. Court documents say ICE Enforcement and Removal Operations officers targeted the stop because an immigration judge had already issued a final order of removal against him. Breitbart News reported the charging details as the case moved into federal court in the Western District of Texas. That sequence, a lawful removal order, a traffic…Open

What was the justification for the initial traffic stop conducted by ICE ERO officers on September 20?
The stop was targeted and not random, as officers had confirmed that an immigration judge had already issued a final order of removal against Garces-Perez.
Q&A ID c33fc2f8-9b7e-47b3-b1ad-0f1dfc2803cf
How did local Austin leadership respond to the shooting involving the ICE officer?
Local leaders criticized the federal officers; Austin Police Chief Lisa Davis stated the city "deserves answers," and Mayor Kirk Watson expressed anger, claiming he was "not surprised" given the "chaos" he believes ICE performs.
Q&A ID 066c71e4-9297-4ee3-9a6d-495f0643cbb7
What are the details regarding the shooting involving Garces-Perez and the subsequent medical treatment?
During the pursuit, the complaint alleges Garces-Perez attempted to strike an officer with his car, prompting the officer to fire his pistol. Garces-Perez was wounded by a single gunshot to his upper back, which left him in serious but stable condition with a bullet lodged in his back, and he was treated for left-side paralysis.
Q&A ID 6afc11f5-3551-4208-9a74-b01aa85a1d5b
According to the criminal complaint, how did the encounter between ICE officers and Wilber Rafael Garces-Perez escalate into a pursuit?
After being stopped by ICE Enforcement and Removal Operations (ERO) officers, Garces-Perez allegedly ignored commands to park and exit the vehicle, closed his window, and drove off, striking an officer in the torso with his driver’s side-view mirror. This led to a high-speed chase through commercial and residential areas.
Q&A ID 72527f3c-bcf6-4513-9ac8-c19fc342ca2c
Keywordsiceimmigrationaustintexasvenezuelaborder-securitymigrant-crisisdeportationassault-on-a-federal-officerdhslaw-enforcementcriminal-justicefederal-agentsillegal-immigrantpublic-safetyshootingarrestjustice-departmentsocialistsanctuary-citiesmigrant-crimemexicous-newsbreaking-newslegalfederal-courtwestern-district-of-texasremoval-order

AMERICANALMANAC (Sadie Smith) - Dr. Nicole Saphier clears Senate committee hurdle for surgeon general

Dr. Nicole Saphier advanced out of a key Senate panel on a 12-11 vote, moving President Trump’s third surgeon general nominee closer to confirmation over Democratic vaccine objections. The Senate Committee on Health, Education, Labor and Pensions voted Wednesday to send the radiologist’s nomination to the full Senate, NBC News reported. Timothy Westlake, tapped as […] The post Dr. Nicole Saphier clears Senate committee hurdle for surgeon general appeared first on American Almanac .

Dr. Nicole Saphier advanced out of a key Senate panel on a 12-11 vote, moving President Trump’s third surgeon general nominee closer to confirmation over Democratic vaccine objections. The Senate Committee on Health, Education, Labor and Pensions voted Wednesday to send the radiologist’s nomination to the full Senate, NBC News reported . Timothy Westlake, tapped as assistant secretary for mental health and substance use at the Department of Health and Human Services, advanced on the same en bloc vote. Full Senate timing remains unclear. The nominees are expected to win approval. Saphier is President Donald Trump’s third pick for the post after earlier choices stalled. She is a radiologist and former Fox News Channel contributor who…Open

What was the status of Timothy Westlake's nomination during the same Senate committee vote?
Timothy Westlake, who was tapped as the assistant secretary for mental health and substance use at the Department of Health and Human Services, advanced on the same en bloc vote as Dr. Saphier.
Q&A ID 3abbeda5-8edf-4df4-9f88-c46717bf0f80
Who were the previous nominees for Surgeon General before Dr. Nicole Saphier was tapped by President Trump?
Dr. Saphier follows the withdrawals of Dr. Casey Means and Janette Nesheiwat; the article notes that Dr. Casey Means failed to gain enough Senate support.
Q&A ID 5a67faa7-296a-46f5-933c-c617a2f65395
What was Dr. Nicole Saphier's testimony regarding the link between vaccines and autism, as well as the MMR and hepatitis B vaccines?
Dr. Saphier stated that she does not believe childhood vaccines cause autism, described the MMR shot as the country's strongest defense against measles, and stated that the universal birth dose of hepatitis B is safe and effective.
Q&A ID bdfe537d-f983-4eb4-8908-5e9333234d62
What specific vaccine-related topics did Senators question Dr. Nicole Saphier about during her September 16 hearing in Washington?
During her confirmation hearing, Senators pressed her on childhood vaccines, autism claims, and the hepatitis B birth dose.
Q&A ID af499e84-822a-4b8a-9e82-41ca2533bd98
Keywordsnicole-saphiersurgeon-generaltrumpsenaterepublican-partyhealthcarehhsrfk-jrmedicinepublic-healthvaccinesconfirmation-hearingcongresssenate-confirmationsenator-bernie-sanderssenator-bill-cassidyfox-newsmemorial-sloan-ketteringradiologistus-politicswhite-househealth-policymedical-newsus-governmentpoliticsnationalelection-2026maha

BABYLONBEE (Babylon Bee) - King Solomon Asks 1,000 Wives And Concubines If There Is Anything To Charges That He Is A Patriarchal Misogynist

JERUSALEM — King Solomon held court with his 700 wives and 300 concubines to ask whether or not there is anything to the charges he is a patriarchal misogynist.

Keywordscomedysatirereligionchristianitybibleking-solomonpatriarchymisogynyculture-warfaithfunnybabylon-beeentertainmentgender-rolessocietytraditionalismopinionsocial-commentaryjerusalembible-stories

YOUTUBE (Fox News) - NEW DETAILS: Pilot changed transponder code to signal hijacking

Click to play Video
▶️

The 'Outnumbered' panel weighs in on the cockpit attack on a flydubai flight, that was bound for Israel, that was forced to make an emergency landing in Saudi Arabia after a pilot was stabbed. #foxnews #world #news #middleeast #fox Don’t just watch Fox News—be part of it. Become a Fox News Patriot today. https://youtube.com/foxnews/join

Keywordsaviationmiddle-eastwarsaudi-arabiacaught-on-camerageopoliticsisraelnational-securityemergency-landingflydubaiconflictusdefensemilitaryairstrikesdubaiforeign-policytel-avivirannetanyahufox-newshijackingcockpit-attackregional-instability