News chronological

Showing 10 items before 1160645

Filters Applied:

NYTIMES (Dana G. Smith) - How Drinking Affects Your Dementia Risk

Researchers are still investigating what alcohol does to the brain, and what (if any) amount is safe.

What is the current scientific understanding regarding the relationship between alcohol consumption and dementia risk as of September 2026?
Researchers are still investigating the connection between alcohol and dementia risk, specifically looking into what alcohol does to the brain and whether any amount of alcohol consumption is safe.
Q&A ID 9cf54bcb-f548-4e3b-9e15-a59bcb7d3de7
What are researchers currently investigating regarding alcohol and the brain?
Researchers are still investigating what alcohol does to the brain and determining if there is any amount of alcohol consumption that is considered safe.
Q&A ID 6775ce43-520d-4dad-b4b1-5a4095ebc9f4
What are researchers currently investigating regarding alcohol and the brain?
Researchers are investigating what alcohol does to the brain and whether any amount of alcohol consumption is safe.
Q&A ID 4a9ff093-2e59-4492-a50a-d8cff1a23bb0
Keywordsalcoholdementiabrain-healthneurosciencehealthsciencestudymedicineneurologylongevitypublic-healthagingalzheimersalzheimers-diseasebiomarkerdiagnosisfdamemory-loss

NEWSNATIONNOW (Alicia Sitz) - Naturally occurring human peptide shows promise against Alzheimer's

"The study suggests that peptide-based therapies may offer a new approach to treating complex neurodegenerative diseases."

According to research, what potential do naturally occurring human peptides show in relation to Alzheimer's disease?
They show promise against Alzheimer's disease, with studies suggesting that peptide-based therapies may offer a new approach to treating complex neurodegenerative diseases.
Q&A ID b1c162f4-1f2d-40ce-acf8-02e129f11151
What has been suggested regarding the use of naturally occurring human peptides in the treatment of Alzheimer's disease?
The study suggests that peptide-based therapies may offer a new approach to treating complex neurodegenerative diseases like Alzheimer's.
Q&A ID 3c7a3564-c527-44b8-8200-83501949af41
What type of substance has shown promise in research against Alzheimer's disease?
A naturally occurring human peptide has shown promise against Alzheimer's.
Q&A ID 309e20a0-0962-423a-a364-0b81a481fb15
What does the study regarding a naturally occurring human peptide suggest about the treatment of Alzheimer's?
The study suggests that peptide-based therapies may offer a new approach to treating complex neurodegenerative diseases, such as Alzheimer's.
Q&A ID 0860be02-a446-4a7e-914f-11ed106fd205
Keywordshealthmedicinemedical-researchsciencealzheimerspeptideneurodegenerative-diseasebiotechbiotechnologyhealthcarewellnesslongevitybiomedicalpharmaceuticals

WASHINGTONPOST (Daniel Wu) - One blood test could screen you for 50 cancers. Here’s why it’s controversial.

A Food and Drug Administration committee backed a cancer blood test called Galleri but was split on how well it works. The test is awaiting a final decision by the FDA.

When was the article regarding the Galleri blood test published?
The article was published on Thursday, September 24, 2026.
Q&A ID e025317e-4121-4981-b9cb-c11ae4e427ea
Why is the Galleri blood test considered controversial?
The test is controversial because, although an FDA committee backed the test, the committee members were split on its effectiveness.
Q&A ID b2a337ec-dad5-421a-bbc7-4e0cde5863e4
What is the name of the cancer blood test that can screen for 50 different types of cancer?
The cancer blood test is called Galleri.
Q&A ID 10f2b1db-2c21-4c53-b565-b3f0a9791a98
Keywordshealthhealthcaremedicinebiologymedical-researchpublic-healthsciencefdacancerdiagnosticsbiotechblood-testdiagnosisdetectionsenatecongressmedical-sciencedoctorsbiomarkerlongevityneurosciencestudyscreeninggallerifda-committee

BITCHUTE (PragerU) - Peptides: Medical Breakthrough or Risky Shortcut? | Dr. Jared Ament & Dr. Jon Kanevsky 2026-09-23 ..

Click to play Video
▶️

Peptides, supplements, GLP-1 weight-loss drugs, NAD, IV drips, and “longevity stacks” are everywhere. But how much do people really know about what they are putting into their bodies? Dr. Jared Ament and Dr. Jon Kanevsky join PragerU CEO Marissa Streit to explain the potential benefits of peptides, why so many Americans are experimenting with them, and why the gray-market peptide industry can be risky. They break down FDA approval, third-party testing, China-based sourcing, growth hormone peptides, Ozempic, retatrutide, creatine, NAD, and the role of AI in helping patients research their own health. They also discuss why good medicine requires both curiosity and humility. This episode is part of a series of medical interviews. The…

What topics did Dr. Jared Ament and Dr. Jon Kanevsky cover concerning medical practice and patient research?
They discussed why good medicine requires both curiosity and humility, as well as the role that AI plays in helping patients conduct their own health research.
Q&A ID bf433dd4-cc68-4d3a-8be0-e6982238e787
What are some of the risks mentioned regarding the peptide industry?
The discussion highlights that the gray-market peptide industry can be risky and raises questions about how much people truly know about what they are putting into their bodies.
Q&A ID 2395d233-6540-43d5-9417-43f4b11c7cb3
What specific health-related topics and substances were discussed by Dr. Jared Ament and Dr. Jon Kanevsky?
The discussion covered peptides, supplements, GLP-1 weight-loss drugs, NAD, IV drips, “longevity stacks,” FDA approval, third-party testing, China-based sourcing, growth hormone peptides, Ozempic, retatrutide, creatine, and the role of AI in helping patients research their own health.
Q&A ID c25ab39d-eac1-4921-a497-fd94fcec3029
Who were the featured medical experts in the discussion regarding peptides and longevity stacks on September 23, 2026?
The discussion featured Dr. Jared Ament and Dr. Jon Kanevsky.
Q&A ID 73b4b4b6-08b3-4d77-8e11-9a8531715e47
Keywordspeptideshealthcarewellnessmedical-researchmedicinepharmaceuticalshealthcompounding-pharmacylongevityrfk-jrfdaregulationsciencetelehealthweight-lossbiotechglp-1public-healthbiohackingfda-approvalchinaozempicretatrutideaipragerumedical-breakthroughsupplementgrowth-hormonenad

YOUTUBE (LiveNOW from FOX) - Is melatonin safe for kids?

Click to play Video
▶️

Dr. Anya McLaren-Barnett, pediatric respirologist, sleep medicine physician and founder of The Sleep Health Organization, joins LiveNOW's Alexandra Goldberg on how to maintain good sleep health during the busy back-to-school season.

Keywordsmelatoninhealthwellnesschild-safetychildrenpediatricsleep-healthmedicinedoctorsnutritionparentingsafetylongevityeducationlifestylebiologybrain-healthhealthcaredigital-healthawareness

YOUTUBE (CNN) - 90-year-old bodybuilder wins major competition in Japan

Click to play Video
▶️

Toshisuke Kanazawa is a 90-year-old bodybuilder from Hiroshima, Japan, who has become an online sensation after winning the 85-and-over category in the All Japan Masters Fitness Championships last week – while following a strict vegetarian diet.

Keywordssportsfitnessathleteentertainmentbodybuildingjapanhiroshimawellnesslongevitymartial-artshealthcompetitioncelebritylegendinspiring

AMERICANALMANAC (Alex Tanzer) - Japan tops 100,000 centenarians — while its birth rate hits a record low

Japan now counts more than 107,000 residents aged 100 or older, a milestone that doubles as a warning sign for a nation whose fertility rate has fallen to its lowest level on record. The country's Health and Welfare Ministry released figures Tuesday showing 107,677 centenarians living in Japan, up 7,914 from the previous year and […] The post Japan tops 100,000 centenarians — while its birth rate hits a record low appeared first on American Almanac .

Japan now counts more than 107,000 residents aged 100 or older, a milestone that doubles as a warning sign for a nation whose fertility rate has fallen to its lowest level on record. The country's Health and Welfare Ministry released figures Tuesday showing 107,677 centenarians living in Japan, up 7,914 from the previous year and past the 100,000 mark for the first time. The announcement, timed to Japan's Sept. 15 Respect the Aged Day, drew praise from Health Minister Kenichiro Ueno, and an immediate pivot to the demographic crisis those numbers help illustrate. Nearly 88 percent of the centenarians are women. The oldest Japanese woman, 114-year-old Fuyo Kishimoto of Kyoto, was recently recognized for the distinction. Japan's oldest man,…Open

Keywordsjapandemographicsbirth-ratepopulation-declinecentenarianslongevityfertility-ratesocial-securityaging-populationpublic-healtheconomygeopoliticsasiasocial-trendscensusmedical-technologymarriage-ratestax-basepensionshealthcaredemographic-shiftsocial-issuesreproductionfamilyeconomic-impactkenichiro-uenosanae-takaichisocial-security-systemeconomic-trendsglobal-demographics