Doctors prescribing the medication say they're doing it because severe childhood obesity is getting more dangerous.
| Keywords | wegovyglp-1obesitychildhood-obesityhealthmedicinepediatricsweight-lossdiabetesmedical-newsdoctorshealthcarewellnessmedicationlifestyle-drugsozempicpublic-healthchildren |
Host Robert Sherman monitors meetings in Switzerland between the U.S. and Iran. Both sides walked away from the discussions saying they are pleased with the progress that was made. Among the biggest headlines was that Iran agreed to allow IAEA investigators, the UN's nuclear watchdog, into the country, though the timing is still being debated. #marcorubio #iran #nuclear
Iranian Presidency Office via AP Editor: Diana Zapata Published June 28, 2026 The reported Iranian strikes against Bahrain mark another dangerous step in an already volatile regional crisis. According to multiple news reports, Iran launched [...]
'Temporary Protective Status was never intended to be permanent'
| Keywords | markwayne-mullinjake-tappercnnstate-uniontpstemporary-protected-statusimmigrationus-immigrationborder-securityrepublicansenatepoliticsred-green-axisjudicial-warfare |
| Keywords | trumpdonald-trumpkazakhstanpresident-of-kazakhstanforeign-policymiddle-eastinternational-relationsgeopoliticsredstateopinionward-clarkenergy-securityglobal-politics |
Many of the dead dogs had gunshot wounds, authorities said.
| Keywords | californiadogsanimal-crueltyshelterdeathinvestigationlaw-enforcementusanimalspetsanimal-neglecttragedywildlifenaturecrimeshootingpet-adoptionrescueanimal-controllos-angeles |
Canadian wokery continues. Now it's the muezzin calling Muslims to prayer. Why not dogs barking instead?
| Keywords | canadapoliticsislamradical-islammuezzinmuslimreligionsocialismleftistred-green-axiswokismculture-warextremismnational-securitysecuritygeopoliticsislamismthreatscanada-news |
The firefighters died in a blaze in Colorado. Fires have swept the arid border region after a warm winter produced less snow than normal.
| Keywords | wildfirescoloradoutahfirefightersdeathsnatural-disasterweatherususaclimate-changeextreme-heatemergencyfire-seasonbreaking-newsnytimesenvironmentpublic-safetyaridsnowpackmountain-west |
Some GLP-1 users are cutting back on physical activity as weight loss kicks in, which can lead to muscle mass. Dr. Anahita Dua, a vascular surgeon, tells “NewsNation Prime” that’s a mistake. Her advice: Do some weight training and get enough protein. #GLP1 #WeightLoss "NewsNation Prime" is America’s source for unbiased news offering a full range of perspectives from across the U.S. Weekends starting at 7p/6C. #Prime NewsNation is your source for fact-based, unbiased news for all Americans.
A federal lawmaker announced this week that MIT has agreed to release a recording related to a series of UAP sightings over Washington D.C. in July 1952. To Disclosure Foundation Executive Director Jordan Flowers, this represents significant progress: “The gloves are coming off, in terms of pushing for transparency, and knowing where these things are and pulling them out of the right structures.” #UFO #InvasionOfWashington #Disclosure "NewsNation Prime" is America’s source for unbiased news offering a full range of perspectives from across the U.S. Weekends starting at 7p/6C. #Prime NewsNation is your source for fact-based, unbiased news for all Americans.