AMERICANTHINKER - The Information State: Its Impact On Freedom
Book Cover Jacob Siegel’s brand new book focuses on how rulers and elites use digital tools to calibrate information and control the masses.
Book Cover Jacob Siegel’s brand new book focuses on how rulers and elites use digital tools to calibrate information and control the masses.
Photo Credit:James Stuart, Public domain, via Wikimedia Commons Public Domain Demographic eclipse and cultural surrender in post-Christian Europe.
ChatGPT America’s 250th is a great moment to stop and review some of our greatest hits.
| Keywords | americausa-250thamerican-revolutionhistorypatriotismlibertyfreedomconservativepoliticsus-politicsculture-warfounding-fathersamerican-heritageamerican-dreamusarepublicanamerican-greatness |
Public domain What would the oddsmaker have given to anyone crazy enough to bet, back in 1775, that the Continental Army would defeat the Brits?
| Keywords | american-thinkerpatriotismrevolutionary-warcontinental-armyusalibertyhistoryfounding-fathersindependencemilitaryfreedombraverybritainukunited-kingdompoliticssovereigntynationalism |
Matt Popovich However, it’s dramatically increased presidential power, something that needs to change quickly if we are to maintain our constitutional system.
Both the U.S. and Iran have said they remain committed to standing down under the current framework.
| Keywords | usirandohaqatarwarpeace-talksceasefirediplomacygeopoliticsmiddle-eastforeign-policynegotiationstehranregional-securityinternational-relationsconflict |
Plus, a daring rescue mission in space.
| Keywords | supreme-courttrumpus-politicsheat-waveweatherclimate-changespacenasawhite-housejustice-systemgeopoliticseconomynytimesusanational-newsenvironmentenergyjudicial-warfarered-green-axis |
Approximately 1.3 million illegal migrants have applied for Spain's mass amnesty program as the month-end deadline approaches.
Spain’s asylum system has been flooded with roughly 1.3 million applications ahead of the deadline later this month, following the far-left government’s plan to grant mass amnesty to illegal migrants in the country. It was claimed that only 500,000 would apply. PULSE POINTS WHAT HAPPENED: Approximately 1.3 million illegal migrants have applied for Spain’s mass amnesty program as the month-end deadline approaches. DETAIL: The Spanish government, led by far-left Prime Minister Pedro Sánchez, began accepting amnesty applications in April. Applicants who qualify for asylum will receive legal residency and work permits, among other benefits. The program application deadline is June 30. Despite warnings earlier in the year that the number…Open
| Keywords | immigrantsamerican-valuesimmigrationus-politicsredstateguest-editorialnationalismintegrationamericapolicycultural-identitypatriotism |
More U.S. scientists are heading abroad. Three researchers explain why they decided to shift their research to universities in the U.K.