Plus, the Friday news quiz.
| Keywords | trumppoliticselectionelection-2026anti-trumpdemocratseconomyhealthcareinflationmainstream-mediamediamedia-biasgeopoliticsamerica-firstcancer-treatments |
The attack, on a flight from Dubai to Tel Aviv, halted the only direct service between the two cities since the war in Iran disrupted air traffic.
From a viral story on a lesbian bar’s masking policy to Nikole Hannah-Jones' essay on making school segregation a personal issue to the “Cornell Seven,” Audie and Ari connect the dots on the internet’s reckoning with "Woke 1.” 0:00 We need to talk about the Boston Globe lesbian bar masking story, because it's about a lot more than masks 5:04 Why did this blow up and inspire so much passion on the left and the right? 7:38 We're getting in the time machine and going back to 2020 and the origin of 'Woke 1' 9:33 What's really going on with this sudden reexamination of woke politics on the left? 11:41 Speaking of reexamination, Nikole Hannah-Jones has some regrets 18:20 The backlash to all of this is...complicated 22:55 Consider, too,…
Flydubai's pilot Smit Machchhar describes the dramatic moment he was attacked by his co-pilot in Wednesday’s suspected hijacking attempt. He made his first public remarks on a video call with India’s Prime Minister Narendra Modi. #cnn #flydubai #flydubaipilot
| Keywords | flydubaihijackingpilotherosmit-machchharnarendra-modiindiaaviationflight-securityterrorismcrimecaught-on-cameramiddle-eastgeopoliticsemergencyattackaircraftpoliticsbreaking-news |
AI for American Thinker By Janet Levy President Trump’s disputes with the media may seem contentious, but are no different from those of Lincoln and Democrats like FDR, LBJ, and Obama.
| Keywords | trumppoliticsmediamainstream-mediapresidentdonald-trumprepublicandemocratobamafdrlbjlincolnculture-warelection-2026americausgovernmentmedia-biascensorshipfreedom-of-speechjournalismanti-trump |
AI for American Thinker By Yehezkel Schiff For those who want to realign their sexual attractions, the therapy can be successful, and no free country should deny people this chance.
ChatGPT for American Thinker By Arik Arad Commercial aviation remains a prime target, and the nature of the threat is rapidly shifting.
AI for American Thinker By Jerold Levoritz For those Jews questioning their allegiance to Judaism in these trying times, this is a reminder of the myriad blessings that flow from fealty to the faith.
| Keywords | antisemitismjudaismjewishreligionfaithculture-waridentity-politicsamericasocial-issuesradical-leftanti-westernideologyjewish-communityconflictsociety |
Perchance AI By J. Robert Smith
Photo Credit:Titian, Public domain, via Wikimedia Commons Public Domain By Lars Møller Why conservatism must roll the warning against totalitarianism up every new hill.
| Keywords | conservatismtotalitarianismpoliticsideologywarningculture-waramericausa |